CDS

Accession Number TCMCG006C51824
gbkey CDS
Protein Id XP_013729631.1
Location join(28999288..28999362,28999457..28999522,28999600..28999641,28999745..28999867)
Gene LOC106433329
GeneID 106433329
Organism Brassica napus

Protein

Length 101aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA293435
db_source XM_013874177.2
Definition lon protease homolog 1, mitochondrial-like [Brassica napus]

EGGNOG-MAPPER Annotation

COG_category O
Description ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix. May also have a chaperone function in the assembly of inner membrane protein complexes. Participates in the regulation of mitochondrial gene expression and in the maintenance of the integrity of the mitochondrial genome. Binds to mitochondrial DNA in a site-specific manner
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
ko01002        [VIEW IN KEGG]
ko03029        [VIEW IN KEGG]
KEGG_ko ko:K08675        [VIEW IN KEGG]
EC 3.4.21.53        [VIEW IN KEGG]        [VIEW IN INGREDIENT]
KEGG_Pathway -
GOs GO:0000166        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0004176        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005524        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005739        [VIEW IN EMBL-EBI]
GO:0005759        [VIEW IN EMBL-EBI]
GO:0005829        [VIEW IN EMBL-EBI]
GO:0006508        [VIEW IN EMBL-EBI]
GO:0006515        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0007005        [VIEW IN EMBL-EBI]
GO:0008144        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0008233        [VIEW IN EMBL-EBI]
GO:0009056        [VIEW IN EMBL-EBI]
GO:0009057        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0016462        [VIEW IN EMBL-EBI]
GO:0016787        [VIEW IN EMBL-EBI]
GO:0016817        [VIEW IN EMBL-EBI]
GO:0016818        [VIEW IN EMBL-EBI]
GO:0016887        [VIEW IN EMBL-EBI]
GO:0017076        [VIEW IN EMBL-EBI]
GO:0017111        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0030163        [VIEW IN EMBL-EBI]
GO:0030554        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0032553        [VIEW IN EMBL-EBI]
GO:0032555        [VIEW IN EMBL-EBI]
GO:0032559        [VIEW IN EMBL-EBI]
GO:0035639        [VIEW IN EMBL-EBI]
GO:0036094        [VIEW IN EMBL-EBI]
GO:0042623        [VIEW IN EMBL-EBI]
GO:0043167        [VIEW IN EMBL-EBI]
GO:0043168        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044248        [VIEW IN EMBL-EBI]
GO:0044257        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044265        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044429        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0051603        [VIEW IN EMBL-EBI]
GO:0070011        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:0097367        [VIEW IN EMBL-EBI]
GO:0140096        [VIEW IN EMBL-EBI]
GO:1901265        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]
GO:1901565        [VIEW IN EMBL-EBI]
GO:1901575        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGAGAAAAACATAAATGATCTGAAAGGGAAAGATCTGCTTAAACGGCTTCACGAAGTTGGCACACTTGCTCAGATTTCAAGTATCCAAGGAGATCAAGTTATCCTCGTTGGTCATAGACGGCTTCGCATAACGGAGAAGGTGAGTGAAGAGCCACTTACAGTCAAAGTCGATCATCTTAAGGATAAGCCGTTTGACATGGACGATGATGTCATCAAGGCAACATCCTTTGAAGTTATTTCAACGCTTAGGGATGTACTGAAGACAAGCTCACTGTGGAGAGACCACGTCCAAACATATACCTAG
Protein:  
MEKNINDLKGKDLLKRLHEVGTLAQISSIQGDQVILVGHRRLRITEKVSEEPLTVKVDHLKDKPFDMDDDVIKATSFEVISTLRDVLKTSSLWRDHVQTYT